Human EPO Protein, Fc Tag

Name: Human EPO Protein, Fc Tag
Brand: KMD Bioscience
SKU: KMPH1383

Product Number

KMPH1383

Alias

Erythropoietin(EPO), Erythropoietin, EPO, human EPO, human Erythropoietin, EPO Protein, human EPO Protein

Specifications

100ug
1mg

DATASHEET MSDS

Inquire Now Add to Inquiry List Bulk Packaging Customization

Product Description

Alias	Erythropoietin(EPO), Erythropoietin, EPO, human EPO, human Erythropoietin, EPO Protein, human EPO Protein
Catalog Number	KMPH1383
Molecular Name	Erythropoietin, EPO
Species	Human
Host	HEK293 Cells
Size	100ug, 1mg
Purity	> 95% as determined by Tris-Bis PAGE, > 95% as determined by HPLC
Endotoxin	< 10 EU per mg protein.
Formulation	Lyophilized from sterile PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Background	Erythropoietin is a member of the EPO / TPO family. It is a secreted, glycosylated cytokine composed of four alpha helical bundles. Erythropoietin can be found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. It also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. Genetic variation in erythropoietin is associated with susceptbility to microvascular complications of diabetes type 2. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. It has a longer circulating half-life in vivo. Erythropoietin is being much misused as a performance-enhancing drug in endurance athletes.
Application	SDS-PAGE, WB, ELISA
Tag	hFc tag
Biological Activity	Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 2.0-8.0 ng/mL.
Predicted N Terminus	Ala 28
Reconstitution	Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water.
Storage Condition	Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Shipping Condition	In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Sequence	MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAEN ITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVL RGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAAS AAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Molecular Weight	The recombinant human EPO consists 404 amino acids and predicts a molecular mass of 45.1 kDa.
Uniprot ID	P01588
Note	For Research Use Only!

PRODUCT CENTER

Human EPO Protein, Fc Tag

Product Number

Alias

Specifications

Monoclonal Mouse Anti HA-Tag（Primary Antibody）

Streptococcus suis sao protein

Anti-Human VEGFA Recombinant Antibody(Aflibercept)

Anti-Human CD326 Recombinant Antibody(Citatuzumab Bogatox)

Login

Don’t have an account?Sign Up Now

Register

Already have an account?Log In Now

Inquire Now

Name*

Phone*

E-mail*

Content*