Human PDGFRA Protein, His Tag
-
Product Number
KMPH2185
-
Alias
Platelet-Derived Growth Factor Subunit A, Human PDGFA Protein, His Tag, PDGFA, Platelet-Derived Growth Factor A
-
Specifications
- 50ug
- 100ug
- 500ug
- 1mg
Product Description
| Alias | Platelet-Derived Growth Factor Subunit A, Human PDGFA Protein, His Tag, PDGFA, Platelet-Derived Growth Factor A |
| Catalog Number | KMPH2185 |
| Molecular Name | PDGFA |
| Species | Human |
| Host | Yeast |
| Size | 50ug, 100ug, 500ug, 1mg |
| Purity | > 95% as determined by Tris-Bis PAGE |
| Endotoxin | Less than 1EU per ug by the LAL method. |
| Formulation | Lyophilized from sterile 30 % ACN, 0.1 % TFA. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. |
| Background | Platelet-derived growth factors (PDGFs) may play an important role in the development of atherosclerosis acting as chemoattractants and mitogens for vascular smooth muscle cells and macrophages. PDGFA, the most known member of PDGF family, plays a crucial role in occurrence and progression of different tumors. |
| Application | SDS-PAGE, WB, ELISA |
| Tag | His tag |
| Predicted N Terminus | His |
| Reconstitution | Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water. |
| Storage Condition | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Shipping Condition | In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
| Sequence | SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTS SVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNP DYREEDTGRPRESGKKRKRKRLKPT |
| Molecular Weight | The recombinant human PDGFA consists of 140 amino acids and predicts a molecular mass of 16.3 kDa. |
| Uniprot ID | P04085 |
| Note | For Research Use Only! |
- Protein Platform
- Protein Expression Services
- Protein Modification & Detection Services
- Protein Interaction Services
- Protein Purification Service
- Antibody Discovery Platform
- VHH Antibody Platform
- Phage Display Platform
- Antibody Humanization Platform
- Single B Cell Screening Platform
- Antibody Expression & Validation Platform
- Peptide Library Platform
- Custom Antibody Platform
- Innovative Drug Discovery Platform
- Product Center
- Proteins
- Antibodies
- Raw Materials Reagents
- Small Molecule Reagents
- Peptide Products
- Nanoparticle Products
- Contact Us
- Phone：400-621-6806
- Mobile：13110936064（WeC
- E-mail：[email protected]
- Address：Room 108, Building 10, No. 6 Hechang Road, Wuqing Development Zone, Tianjin City
-
WeChat
-
Service Account
-
400-621-6806 -
3599163699 -
Monday to Friday 9:00-18:00 -
-
0
-
