Human IL15 Protein
-
Product Number
KMP2005
-
Alias
Interleukin-15, L15, IL-15, IL-15MGC9721, interleukin 15, interleukin-15
-
Specifications
- 10ug
- 100ug
- 500ug
- 1mg
Product Description
| Alias | Interleukin-15, L15, IL-15, IL-15MGC9721, interleukin 15, interleukin-15 |
| Catalog Number | KMP2005 |
| Molecular Name | Interleukin 15, IL 15 |
| Species | Human |
| Host | E.coli |
| Size | 10ug, 100ug, 500ug, 1mg |
| Purity | > 95% as determined by Tris-Bis PAGE, > 95% as determined by SEC-HPLC |
| Endotoxin | Less than 1EU per ug by the LAL method. |
| Formulation | Lyophilized from 0.22um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization. |
| Background | Interleukin 15 (IL-15) is a widely expressed 14 kDa cytokine that is structurally and functionally related to IL-2 and plays an important role in many immunological diseases.IL-15 is a cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL15 requires interaction of IL15 with components of the IL2 receptor, including IL2RB and probably IL2RG but not IL2RA. |
| Application | SDS-PAGE, WB, ELISA |
| Tag | No Tag |
| Biological Activity | Immobilized Human IL-15 at 1ug/ml (100ul/Well) on the plate. Dose response curve for Human IL-15RA, His Tag with the EC50 of 22.1ng/ml determined by ELISA. |
| Predicted N Terminus | Asn 49 |
| Reconstitution | Centrifuge the tube before opening. Reconstituting to a concentration more than 100 ug/ml is recommended. Dissolve the lyophilized protein in distilled water. |
| Storage Condition | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Shipping Condition | In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise. |
| Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQ VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNI KEFLQSFVHIVQMFINTS |
| Molecular Weight | The protein has a predicted MW of 12.8 kDa same as Tris-Bis PAGE result. |
| Uniprot ID | P40933 |
| Note | For Research Use Only! |
- Protein Platform
- Protein Expression Services
- Protein Modification & Detection Services
- Protein Interaction Services
- Protein Purification Service
- Antibody Discovery Platform
- VHH Antibody Platform
- Phage Display Platform
- Antibody Humanization Platform
- Single B Cell Screening Platform
- Antibody Expression & Validation Platform
- Peptide Library Platform
- Custom Antibody Platform
- Innovative Drug Discovery Platform
- Product Center
- Proteins
- Antibodies
- Raw Materials Reagents
- Small Molecule Reagents
- Peptide Products
- Nanoparticle Products
- Contact Us
- Phone：400-621-6806
- Mobile：13110936064（WeC
- E-mail：[email protected]
- Address：Room 108, Building 10, No. 6 Hechang Road, Wuqing Development Zone, Tianjin City
-
WeChat
-
Service Account
-
400-621-6806 -
3599163699 -
Monday to Friday 9:00-18:00 -
-
0
-
